PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 434aa    MW: 48899.6 Da    PI: 7.1478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00250.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
       KHN00250.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.58.2e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
       KHN00250.1  67 RGTFSQEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001671.08E-111761No hitNo description
PROSITE profilePS5129425.94862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1366114IPR001005SANT/Myb domain
PfamPF002491.1E-1367111IPR001005SANT/Myb domain
CDDcd001671.84E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS EVENGEKAAE VSNELNLLKS ESSKSDSASY EQRTSISPKA YAPEMDGSCS  180
SKIEINFVTN NNCYNKDLFL DRFMSSSRQE SYTTSCQPSD LMGNFPIQMS YATNDQCLPN  240
DSNSSHWFSQ TGRSFDMNTE FPFNAAVTSI NPTPTTNLFL PNNSFCYKPS LAVPSDNVSI  300
PYGSHYWEAS ASNNSNSSTE LRSSSPLNIF SSWGLADCGT STTKEAQIHM MENHNTEEAK  360
WDEYLHNPIS MLASSVQNQA PESLCNDIKT SMHLVPDTLG AMLPHNHTKQ QEQSQTSSFF  420
SKDIQKLRAA FGHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519722.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2NT940.0A0A0B2NT94_GLYSO; Transcription factor MYB86
TrEMBLK7K5T60.0K7K5T6_SOYBN; Uncharacterized protein
STRINGGLYMA02G00960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-92myb domain protein 55
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]